标题：销售Insulin-Like Growth Factor 1

Insulin-Like
Growth Factor 1, Human Recombinant

Cell
Culture Reagents-Growth Supplements

Catalogue Number: CC105

Description: The somatomedins, or insulin-like growth factors
(IGFs), comprise a family of peptides that play important roles in mammalian growth
and development. IGF1 mediates many of the growth-promoting effects of growth
hormone (GH; MIM 139250). Early studies showed that growth hormone did not
directly stimulate the incorporation of sulfate into cartilage, but rather
acted through a serum factor, termed 'sulfation factor,' which later became
known as 'somatomedin'. Three main somatomedins have been characterized:
somatomedin C (IGF1), somatomedin A (IGF2; MIM 147470), and somatomedin B (MIM
193190). Insulin-Like Growth Factor-I Human Recombinant produced in E.Coli is a
single, non-glycosylated, polypeptide chain containing 70 amino acids and
having a molecular mass of 7655 Dalton.
IGF-I is purified by proprietary chromatographic techniques.

Source: Escherichia Coli.

Physical Appearance: Sterile Filtered Clear
Solution.

Formulation: 0.1mg/ml in 50mM
acetic acid solution with 0.1% BSA added as stabilizer.

Stability: IGF1 should be stored at 4°C between 2-7 days and for future use below -20°C. Please avoid freeze-thaw cycles.

Suitability: Cell culture tested

Purity: Greater than 98.0% as determined by: (a)
Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.

Biological Activity: The ED50, calculated by the
dose-dependant proliferation of murine BALB\C 3T3 cells (measured by
3H-thymidine uptake) is < 1.0 ng/ml, corresponding to a specific activity of
1x10⁶units/mg.

For
most in-vitro applications, IGF-I exerts its biological activity in the
concentration range of 0.2-20 ng/ml.

Protein content: EGF quantitation was carried out by two
independent methods:

Protein
quantitation was carried out by two independent methods:

1. UV
spectroscopy at 280 nm using the absorbency value of 0.502 as the extinction
coefficient for a 0.1% (1mg/ml) solution. This value is calculated by the PC
GENE computer analysis program of protein sequences (IntelliGenetics).

2.
Analysis by RP-HPLC, using a calibrated solution of IGF1 as a Reference
Standard.

Amino acid sequence:

GPETLCGAELVDALQFVCGPRGFYFNKPTGYGSSIRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPTKAA